NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0116195_1040783

Scaffold Ga0116195_1040783


Overview

Basic Information
Taxon OID3300009707 Open in IMG/M
Scaffold IDGa0116195_1040783 Open in IMG/M
Source Dataset NameActive sludge microbial communities of municipal wastewater-treating anaerobic digesters from China - AD_SCU002_MetaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1181
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location
Location NameChina: Chengdu, Sichuan
CoordinatesLat. (o)30.66Long. (o)104.06Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F029451Metagenome / Metatranscriptome188N
F054066Metagenome / Metatranscriptome140N

Sequences

Protein IDFamilyRBSSequence
Ga0116195_10407831F029451N/AVRKLVVDFEDLIASTSSSAGKPSIIEALLSTVDAIFTNNRMLQRSRLSSRNIRGVVRVIGSQAFLRARLERSYKPFLDPDTGEFTYSRYDNRVLTAVCEGALSGRISLDGKSRDEIIRIFQAVGNTGQEQPVGRGGGILGRFDY*
Ga0116195_10407832F054066AGGMFGTTRKPKELNRFRVGKGSPALKAALYRMTNKSYLDIRIYRGYREVTRIVTPDTGMRRFVVDGVGAFVMPNEEQMLRQLHDRHALYIPYNINSSAPGEVTDNLEPVAFVYPPLSPAEFQAELEAQTVADLLAETEKDMSWIWLLAGGAVLIFVLILLFGGA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.