NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0116217_10500193

Scaffold Ga0116217_10500193


Overview

Basic Information
Taxon OID3300009700 Open in IMG/M
Scaffold IDGa0116217_10500193 Open in IMG/M
Source Dataset NamePeat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)764
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil → Peatlands Soil Microbial Communities From Germany And Austria, That Are Sulfate Reducing

Source Dataset Sampling Location
Location NameGermany: Weissenstadt
CoordinatesLat. (o)50.1318Long. (o)11.881Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000092Metagenome / Metatranscriptome2385Y
F004291Metagenome / Metatranscriptome445Y
F007884Metagenome / Metatranscriptome343Y

Sequences

Protein IDFamilyRBSSequence
Ga0116217_105001931F000092GAGVKQHLERQSGVQNVVVSLIDGKVEITPKEDGQIDPVQLLKATYDSGVTAAEMDVTARGRIVKDSSSGFAFQVGPNRSFTLEANESSKALESLAGSETLVTVRGQLYKKPAG
Ga0116217_105001932F004291GGAGGMRIKNFALLVLLGSMIAPAAQAQIKHIEMRVEGMT*
Ga0116217_105001933F007884N/AWLSYRPYESKDGAREWFVGPVLTWLDSQDDRIAGARQRGSGGDSLLGGVTTYIGVRPGTHLWLGMDWNVVHSTDALYMPVRRHVSFGITQQFRLHH*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.