NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0116142_10010041

Scaffold Ga0116142_10010041


Overview

Basic Information
Taxon OID3300009685 Open in IMG/M
Scaffold IDGa0116142_10010041 Open in IMG/M
Source Dataset NameActive sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC033_MetaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7337
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Candidatus Methanofastidiosa(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location
Location NameUSA
CoordinatesLat. (o)39.84Long. (o)-89.0Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F037746Metagenome / Metatranscriptome167N
F070633Metagenome / Metatranscriptome123N
F074119Metagenome / Metatranscriptome120N

Sequences

Protein IDFamilyRBSSequence
Ga0116142_1001004111F070633AGGAGVLDVLHSNSDDGFVYSVRQHLPLGPKRCKSDYNLVVVPLSDGIMTSIERETFNIAMDTEGRLILTRKDRKVQLVFDYDKGFMTGVLGGVLYDTFEVPRHEGTDYHG*
Ga0116142_100100417F074119GAGGMSEIQVFEVLAKILPYLVSLGIGAFAGWELVKTKIHELAEFFNTVDEALYDDAVTEKEFRAIWEKGRILFQWSFAEKKGEA*
Ga0116142_100100419F037746GGAGGMPVDIEWAKANDTVGQEFDANYIPGTTDKDLEDARALMEKLLKKYGSRDALEADERDWAKYKKAMYVVASRSKDTMDAANKTREGLIKRKNLLSKFWEENPDVLFGLSEWQRINIRKYTDLGLLIDQEYLWDLLSELGKEDTIKHLANVANYIYNDTGFLGGTREDYDALKRGPVRSIYLRPTCKSHKTISPSCGNGCSKKE*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.