Basic Information | |
---|---|
Taxon OID | 3300009678 Open in IMG/M |
Scaffold ID | Ga0105252_10027088 Open in IMG/M |
Source Dataset Name | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2081 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (40.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: East River, Colorado | |||||||
Coordinates | Lat. (o) | 38.8898 | Long. (o) | -106.9077 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F004511 | Metagenome / Metatranscriptome | 435 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0105252_100270881 | F004511 | GGA | MVFVSRSHQNVTSAAEVFDVLWESLADVLGTAATATLLRRAIKRAASQNSWPEPITVARNGLDYEYHLPETWKQPGNEEAIDVFRAVAAELRVLLVELTGPVVVRRLSRLAPLLKLGIDFSEESK* |
⦗Top⦘ |