Basic Information | |
---|---|
Taxon OID | 3300009653 Open in IMG/M |
Scaffold ID | Ga0116169_1207433 Open in IMG/M |
Source Dataset Name | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Canada - AD_UKC130_MetaG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 654 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Canada | |||||||
Coordinates | Lat. (o) | 49.25 | Long. (o) | -123.1 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F010244 | Metagenome / Metatranscriptome | 306 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0116169_12074332 | F010244 | AGGAGG | MAHKVKFTHSGKSRAHISNAKLREGREVYRHPEGYFVVLEFEGKSGKFREAFWPEQIIQNQ* |
⦗Top⦘ |