Basic Information | |
---|---|
Taxon OID | 3300009610 Open in IMG/M |
Scaffold ID | Ga0105340_1435178 Open in IMG/M |
Source Dataset Name | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 585 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: East River, Colorado | |||||||
Coordinates | Lat. (o) | 38.9232 | Long. (o) | -106.9519 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F002359 | Metagenome / Metatranscriptome | 567 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0105340_14351781 | F002359 | AGGAG | MTTTYPIADMMIGVRNMIEAAALRRGDQVLLLADTRSDKLTLEALSAGLRFFGAEPMTLVTEPIARYGAVPQQVLEAMHASDVVIWVWPVFITFTPAHRAMGRKREESGTQLHENRMKPYHIYFEGNAGLLARDYAKFPNKVLWKLAEKVREVVAAGKVVRMEDSLGTSLTATYDGKRLY |
⦗Top⦘ |