Basic Information | |
---|---|
Taxon OID | 3300009572 Open in IMG/M |
Scaffold ID | Ga0130020_10127517 Open in IMG/M |
Source Dataset Name | Marine microbial communities associated with Trichodesmium colonies (puff morphology) from Station ALOHA, North Pacific Subtropical Gyre ? SampleE20 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Oregon State University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 525 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Pelagic → Unclassified → Marine → Marine Microbial Communities Associated With Trichodesmium Colonies (Puff Morphology) From Station Aloha, North Pacific Subtropical Gyre |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | North Pacific Subtropical Gyre | |||||||
Coordinates | Lat. (o) | 22.0 | Long. (o) | -158.0 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F067104 | Metagenome / Metatranscriptome | 126 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0130020_101275172 | F067104 | AGGAG | MKLTKETLREIIKEVIAETDAHPQIIKKNKEVAHN* |
⦗Top⦘ |