Basic Information | |
---|---|
Taxon OID | 3300009550 Open in IMG/M |
Scaffold ID | Ga0115013_10011753 Open in IMG/M |
Source Dataset Name | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 4591 |
Total Scaffold Genes | 8 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (25.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | South Atlantic Ocean | |||||||
Coordinates | Lat. (o) | -17.283 | Long. (o) | 2.9768 | Alt. (m) | Depth (m) | 30 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F047903 | Metagenome / Metatranscriptome | 149 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0115013_100117537 | F047903 | N/A | MALKGKYDYKGIEVADAYVKISGVNWNCNSNSENYVKTAAVFNSDGTVKTPEVRADRWVQTTVGNWHANVYKDKAARDGNPNSHICSISGSFDMDLKDSAKNPVKQAYVAAKAMDLYKDMADA* |
⦗Top⦘ |