NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0129284_10001161

Scaffold Ga0129284_10001161


Overview

Basic Information
Taxon OID3300009514 Open in IMG/M
Scaffold IDGa0129284_10001161 Open in IMG/M
Source Dataset NameMicrobial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - F-1W
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Delaware
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)17793
Total Scaffold Genes17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)14 (82.35%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater → Microbial Role In Biogeochemical Cycling In A Beach Aquifer System

Source Dataset Sampling Location
Location NameCape Shores, Lewes, Delaware, USA
CoordinatesLat. (o)38.7855Long. (o)-75.1045Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004237Metagenome / Metatranscriptome447Y
F011880Metagenome / Metatranscriptome286Y

Sequences

Protein IDFamilyRBSSequence
Ga0129284_1000116111F004237GGAMSQYDIADMVRGVQNMIEASDIRAGDQVLLLADRRSDPPSMEAITAGLKMVGAEPMSLITEPISRYGRVPQAVLQAMQASDVVIWVWPVFITFTPDHRAMGRKREESGTQLQEKRMKPYFIYFEGAPGLLARDYAKFPNKVLWKLAEKVREVVAPGKVVRIEDDLGTHLTATYDGSRLYGMQFRAGDPPGRCHFPWGRCGVFNGSGKADGEVYISCVQGVAGQLPGPMRWTVKDSEVVEAEGGELAEECRQLFKNVPGSNRLVEIMFGYHPKASIQYGIADPMHWELISKMPWVGLGTDRKNPTFRHVDGSVMNGRLYIDDRIIVHEQGMLDRSFLHHPEVLEVASEYGDPYQLLAPVSHQAHGSGTLW*
Ga0129284_100011617F011880AGGAGGMATKEQLDAAEKKVYSQKQIGEFMTTWKDFPRPGLAAWAERKKAGLMTTAKSTRYTPKFRPFDMLSIPNQSLVILANENHRIGAECVVGVQDAFHRYVDCDMVYFQFCGNTTLETEFGVYEMEPGEVMLVPGGISHRSVGRNDSLRYFCQTHEAVDYVMDEEKYTSHQTYVMKRVGGPDWSKLEQQDTDRKGRVFEKMHFWDDGPQDETIVERDYDSVVGVATLKPGQEGSGIRKLRAFDHFTTVLGKGGEAGLLALMESANMRVRTYNMQDEQFAFHRALRSEEVRIQFRGDALDLSEFENVPVSPGEITIIPLGISHSVISVPPDDKTFLRLNFYSKVRWRVPIDATHHVFNSRFEVETTVHKEADWWKAAG*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.