Basic Information | |
---|---|
Taxon OID | 3300009506 Open in IMG/M |
Scaffold ID | Ga0118657_10564922 Open in IMG/M |
Source Dataset Name | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Novogene |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1460 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment → Mangrove Sediment Microbial Communities From Mai Po Nature Reserve Marshes In Hong Kong, China |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Mai Po Nature Reserve Marshes in Hong Kong | |||||||
Coordinates | Lat. (o) | 22.498889 | Long. (o) | 114.045833 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F072365 | Metagenome | 121 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0118657_105649222 | F072365 | N/A | MGMSEVGHMSDQRKECQECGWRGTAAELDKNDAPSGDQTHIFCPDCGGANIKDLDPEPKE |
⦗Top⦘ |