NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0118657_10014618

Scaffold Ga0118657_10014618


Overview

Basic Information
Taxon OID3300009506 Open in IMG/M
Scaffold IDGa0118657_10014618 Open in IMG/M
Source Dataset NameMangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterNovogene
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)12784
Total Scaffold Genes16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)12 (75.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment → Mangrove Sediment Microbial Communities From Mai Po Nature Reserve Marshes In Hong Kong, China

Source Dataset Sampling Location
Location NameMai Po Nature Reserve Marshes in Hong Kong
CoordinatesLat. (o)22.498889Long. (o)114.045833Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003721Metagenome / Metatranscriptome472Y
F018779Metagenome / Metatranscriptome233Y
F075054Metagenome / Metatranscriptome119Y
F085469Metagenome / Metatranscriptome111N

Sequences

Protein IDFamilyRBSSequence
Ga0118657_1001461810F003721AGAAGGMAFYAVDVRDRVIQRMTHQSDGVDHKRFFLIEAGSAKRAWAKARRASEATGSAVCGCCRHRHCSDCEECSVTKQYSDYWICHCCGELNPRVPNVHSIE*
Ga0118657_1001461811F075054GGAGGMTYKEHLVFVATRRDAGDCFWLPLVNVCWSEGEKKHMISIKGRPQDRFVYSTEAEASAVGIAREWVDNHVRNGPLA*
Ga0118657_1001461813F085469GGAMQEGSMNLIVRILVGGLTGWLTGKAVEVEGQVKVVREGHGLDMIYGIIGAMVGKYLFFWTVIGKGNALSDYATAVLGSIAVVGAARSLVARWRLAQSHEGNTRPTSVGVGRVIPDGIDPTEASAEQ*
Ga0118657_1001461815F018779AGGAGGMKVNDLGTQISLIGFLTRDLLSGSAARVKEVFTGTRSHGNEENKLSYWQLIFLQSKANGCSYRGKDLPDMPKWQWPTDTWFQERLSHHLKTLESRAQPASN*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.