Basic Information | |
---|---|
Taxon OID | 3300009499 Open in IMG/M |
Scaffold ID | Ga0114930_10019843 Open in IMG/M |
Source Dataset Name | Deep subsurface microbial communities from Anholt, Denmark to uncover new lineages of life (NeLLi) - Anholt_01485 metaG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 4668 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (80.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Denmark: Anholt | |||||||
Coordinates | Lat. (o) | 56.62 | Long. (o) | 11.67 | Alt. (m) | Depth (m) | 31 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F056324 | Metagenome / Metatranscriptome | 137 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0114930_100198434 | F056324 | AGGAGG | MKGKVLIFLMILSVIAVFLGCAESKIYLVDVRYIPEEKAPPTSKVVGICPFEDTRKEKERETIGTRHRPRKKVDLLRLEGISLSESVTQAVKDHFVERGFEVTDCKGWDKSAEGLERLPKDLFLVVAGKIGSFKVEATSGISITDTQYTVKMEAFIGQIEKRKMVTRSIASAPRTKKVGFDPEEVKARLNSILTEVIQRLFEGKF* |
⦗Top⦘ |