NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0127413_10000151

Scaffold Ga0127413_10000151


Overview

Basic Information
Taxon OID3300009494 Open in IMG/M
Scaffold IDGa0127413_10000151 Open in IMG/M
Source Dataset NameMarine sediment microbial communities from Chincoteague Deepwater methane seep, US Atlantic Margin - Chincoteague Seep MUC-5 12-14 cmbsf
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterOregon State University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)22681
Total Scaffold Genes31 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)25 (80.65%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Cold Seeps → Sediment → Methane Seep Sediment → Marine Sediment Microbial Communities From Methane Seeps Within Hudson Canyon, Us Atlantic Margin

Source Dataset Sampling Location
Location NameChincoteague Seep, US Atlantic Margin
CoordinatesLat. (o)37.5409Long. (o)-74.10211667Alt. (m)Depth (m)1055
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F031354Metagenome / Metatranscriptome182Y
F059653Metagenome / Metatranscriptome133Y
F091296Metagenome / Metatranscriptome107Y

Sequences

Protein IDFamilyRBSSequence
Ga0127413_1000015110F091296GGAMVIKRYPHTATLNYYTPGTYNTVGAYTPGTLVTIGITCNIQPNSTKYILGASGDKIGYSWHVLSQNFPGASSVPDGAKLEFFNKEHIILQLFPYQKHTEIKC*
Ga0127413_1000015111F059653AGGAGMTNKEALQSQTEYDNDNLLEKLLLDRGLTPGGTYAATNAKKIDLCAASLYFTLAAHPELREGSFATKYNGTQLLAMSKIILKKYDEDIATIDGDAIW*
Ga0127413_100001518F031354AGGAMKTTIDILDILYPIINIASIKATIDGRIYRNKKPLNSELQDIVILPLSNYTGDEIINDATIMINCFCKNFDNGTPDITKLRATINAVVAVIEAYNSTSNYYIFAITNQILLQDIDQATMSYINLRINCLIEK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.