NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0127401_1002389

Scaffold Ga0127401_1002389


Overview

Basic Information
Taxon OID3300009469 Open in IMG/M
Scaffold IDGa0127401_1002389 Open in IMG/M
Source Dataset NameAquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 6m depth; DNA IDBA-UD
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMarine Biological Laboratory
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5193
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (28.57%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond → Aquatic Microbial Communities From Different Depth Of Meromictic Siders Pond, Falmouth, Massachusetts

Source Dataset Sampling Location
Location NameFalmouth, Massachusetts
CoordinatesLat. (o)41.548517Long. (o)-70.622961Alt. (m)Depth (m)6
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F071199Metagenome / Metatranscriptome122N

Sequences

Protein IDFamilyRBSSequence
Ga0127401_10023893F071199GGAMRFLFALSFLLPVAAFGQSDSAQSPESLGMEQTYTLPFKAHFESGPYQLFSPNTSANNSITGNLSGLQLSMRIHRHFSVGLSVQDAQSQALTETGELLYLDQMRWAGFLASGFLIGVDEYSPWDLSASLGWGYARSSFTETPGVPLVYHQTGYPWVFRVQGHYRHRDSPFLFKHCIILPVEIAFGPQTTLDMRTDKLRTTWLWSLSWPLMGGFLSGGC*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.