Basic Information | |
---|---|
Taxon OID | 3300009455 Open in IMG/M |
Scaffold ID | Ga0114939_10327429 Open in IMG/M |
Source Dataset Name | Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Crystal Spring |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 656 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Ash Meadows Crystal Spring, Nevada | |||||||
Coordinates | Lat. (o) | 36.42 | Long. (o) | -116.32 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F022216 | Metagenome / Metatranscriptome | 215 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0114939_103274291 | F022216 | GAGG | VSTQRVDQGPSDEQRRRIRRNAVVLGLLALGIYVAFIASGVLGLRG* |
⦗Top⦘ |