NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0115008_10061785

Scaffold Ga0115008_10061785


Overview

Basic Information
Taxon OID3300009436 Open in IMG/M
Scaffold IDGa0115008_10061785 Open in IMG/M
Source Dataset NameMarine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2863
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (10.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location
Location NameFram Strait
CoordinatesLat. (o)69.2303Long. (o)7.7302Alt. (m)Depth (m)10
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000352Metagenome / Metatranscriptome1247Y
F005454Metagenome / Metatranscriptome400Y
F008695Metagenome / Metatranscriptome329Y

Sequences

Protein IDFamilyRBSSequence
Ga0115008_100617854F005454N/AMRVIRHYNSHFPDRETYKCTIRHTTKFGTLDEITAWRDDQLKNEDYYKSLEESNRKAAGEFYKTLDYKGD*
Ga0115008_100617856F008695N/AMINEYKVDKVVHEWSEKEDRWIYIEYNAQRKIIGMNFMQGDEYDYFKEKWCHNDQGLTEFYNTMLYTFPIEKASVNTLEFINKVMWSYHQAIVSNEEHREIK*
Ga0115008_100617858F000352N/AMRNIKLTENDITFVHYVLKYYAKYTENLDSDDQEEIYEVANKFK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.