NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0115547_1142769

Scaffold Ga0115547_1142769


Overview

Basic Information
Taxon OID3300009426 Open in IMG/M
Scaffold IDGa0115547_1142769 Open in IMG/M
Source Dataset NamePelagic marine microbial communities from North Sea - COGITO_mtgs_100420
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)769
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location
Location NameGermany:Helgoland, sampling site Kabeltonne, North Sea
CoordinatesLat. (o)54.1883Long. (o)7.9Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F069051Metagenome124Y

Sequences

Protein IDFamilyRBSSequence
Ga0115547_11427691F069051N/ADIDGDPFTGTGISHRTDEILFSGLFQRYHQSFINDNEGQSDLPICIILPSTKKHYLYLKKAQWFRAGNVKISPDALWKKAVGEMPELIIDHAKEIIKLYDIKDTAHFTWIPKFIVRDWYKLEFLQDLEVTYNHQWFDTFKKHPFFAKQKVFHLDLETFFDWGSFIKNITELDRVFGLDLDFDRNKEMKSLFDKGLELDSIRKECNLAESIIEHKEDKSLNDLDVSTEGFIYAETEKRNDFIQMPLTNRFFRDTEE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.