NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0115548_1132011

Scaffold Ga0115548_1132011


Overview

Basic Information
Taxon OID3300009423 Open in IMG/M
Scaffold IDGa0115548_1132011 Open in IMG/M
Source Dataset NamePelagic marine microbial communities from North Sea - COGITO_mtgs_100423
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)795
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location
Location NameGermany:Helgoland, sampling site Kabeltonne, North Sea
CoordinatesLat. (o)54.1883Long. (o)7.9Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011937Metagenome / Metatranscriptome285Y
F048245Metagenome / Metatranscriptome148N

Sequences

Protein IDFamilyRBSSequence
Ga0115548_11320111F011937N/AMKDKKGGFFSEIKNQIVTGIGLVITAAFGLLIANMQSIFEPKEEKVDPPVMEQRINTPNDVKDTLVITKTIVIPPKEDEKEEKISW*
Ga0115548_11320112F048245N/AYTMDWEGETVRWGGYDASFGTYTISNTTELFTLRFRVISQDWDTIPITIGRKTAGTELGWDIEVENTDGYVNKRMAPFDTDPIDGIYGLVYPVPTRGLLTFDLTVPDNGDYEIRVINYNGVVYKRLKKRFFSGYVSFQTDLSDLAQGIYLLQVTNGVYVKTFKIIKK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.