| Basic Information | |
|---|---|
| Taxon OID | 3300009419 Open in IMG/M |
| Scaffold ID | Ga0114982_1006758 Open in IMG/M |
| Source Dataset Name | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4272 |
| Total Scaffold Genes | 12 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 10 (83.33%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Ohio, USA | |||||||
| Coordinates | Lat. (o) | 39.849 | Long. (o) | -81.036 | Alt. (m) | Depth (m) | 2500 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000369 | Metagenome / Metatranscriptome | 1222 | Y |
| F018177 | Metagenome / Metatranscriptome | 236 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0114982_100675812 | F000369 | AGAAG | MSEIELSERFDRMNRVVEELLKGSTPTQIATITGIQRKEVVELIDDWKDVVHNDSNIRDRAREAISGADQHYAMLIKEAWKTVEDADQSGQLGIKSGALKLIADIETKRIAMLQSIGVLENNEIASQIAETERKQDLLVKILKETTSTCPKCKMEVAKRLSQITGIIESVPVEEADVV* |
| Ga0114982_10067582 | F018177 | AGAAG | MPNINEFLNQPEQIFSPELEKIGGAKPCNKCDKDSEEYFWDAVSLTISWECPDGHKNSYSVG* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |