| Basic Information | |
|---|---|
| Taxon OID | 3300009419 Open in IMG/M |
| Scaffold ID | Ga0114982_1001976 Open in IMG/M |
| Source Dataset Name | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 9331 |
| Total Scaffold Genes | 10 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 8 (80.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Ohio, USA | |||||||
| Coordinates | Lat. (o) | 39.849 | Long. (o) | -81.036 | Alt. (m) | Depth (m) | 2500 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F047005 | Metagenome | 150 | N |
| F095456 | Metagenome | 105 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0114982_10019764 | F095456 | GGAGG | MDVTLGRFTVTLKKPASFTLAREVTMAVGTSAIRGLGAALGACWGGKSLKAKYGYDALAYGGAVVDELMALGVPEAEIYAAGKVALDLVIESLPREEAVAQAETFTEAQTEG* |
| Ga0114982_10019766 | F047005 | GGTGG | MAAKSIRQLREDVTARILTLTGWKESRVAPDNFGRDADSIAHKAFAVHPAETADMRAYRGRPAEGLLVETALTVHYCWQLKPKAMSDSYDDALDGEQAVVNVLMAYDASWPLSYKVQVIRTTRTTSDSGEWVLGQVETRIVHTLPLQ* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |