NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0103747_10129452

Scaffold Ga0103747_10129452


Overview

Basic Information
Taxon OID3300009295 Open in IMG/M
Scaffold IDGa0103747_10129452 Open in IMG/M
Source Dataset NameMicrobial communities of wastewater sludge from Singapore - Sludge5_b2_February
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterSingapore Centre on Environmental Life Sciences Engineering (SCELSE)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)660
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wastewater Sludge → Microbial Communities Of Wastewater Sludge From Singapore

Source Dataset Sampling Location
Location NameSingapore
CoordinatesLat. (o)1.2Long. (o)103.45Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002371Metagenome / Metatranscriptome566Y

Sequences

Protein IDFamilyRBSSequence
Ga0103747_101294521F002371N/AMKNKKETRGGTRQGSGAKPKYNEQTKTVAFRCPVSKVDELKLIVKSKLSE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.