| Basic Information | |
|---|---|
| Taxon OID | 3300009172 Open in IMG/M |
| Scaffold ID | Ga0114995_10082133 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1813 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodobacter → unclassified Rhodobacter → Rhodobacter sp. BACL10 MAG-120910-bin24 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Arctic Ocean: Canada Basin | |||||||
| Coordinates | Lat. (o) | 73.2247 | Long. (o) | -150.2247 | Alt. (m) | Depth (m) | 7 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F047554 | Metagenome | 149 | N |
| F057929 | Metagenome / Metatranscriptome | 135 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0114995_100821331 | F057929 | GGA | MLLEFSPPKQPTAIIKLVVKDLVQRFRTSGTETISWFVAEGELVQFDENFDRLERSQMRHRMLHELYQSQTATVLIERSENFPEPHLDGNYCQFGGCSGIGDNVRPTADVRLKSDIYDYVEKAFVMPSPQIEFKLSFTQAIQRAEMSVIFDKPPEPDSGRLSNHFTLDTDAVGGTGLWYADCKLVEIRNVSKYAELIST* |
| Ga0114995_100821332 | F047554 | AGGAG | MTEEYVIKKEHVVIEDDVHAILDLKKAGEIEWYTSSEYDLVAWNKEENCVFGLLKKTGQTYNLSFNVANHGEYDLELDKVLKVCNERFEAMLDW* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |