NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114981_10028197

Scaffold Ga0114981_10028197


Overview

Basic Information
Taxon OID3300009160 Open in IMG/M
Scaffold IDGa0114981_10028197 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3208
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Simoncouche, Canada
CoordinatesLat. (o)48.2311Long. (o)-71.2508Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F080837Metagenome / Metatranscriptome114N
F088194Metagenome / Metatranscriptome109Y
F102437Metagenome / Metatranscriptome101N

Sequences

Protein IDFamilyRBSSequence
Ga0114981_1002819711F080837AGGMMNKKTNNKKHEFFPKMMTTQVLKPYLKEAKRVGYTVSGSVKDGFIAVVTDACEQHPAGEVVMRGVKKPGVNVWIMGFNTLYWQEPTIAECLAESKWYVEMEGASK*
Ga0114981_100281975F088194N/AMMNEVAATSEETTAYALGSTIGTLLNLKRMVEQNMTDYSSNLEGMRGLHPMWSKSELMDQFDRAINKLNTITYPYKI*
Ga0114981_100281978F102437AGGAGMTSKLRAFEDTVLSVREPRELKGSLVCLIQDSDIPTLDKRKLIIAIDRCMTIKDIQRLFYNALLKFEGHGVL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.