NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114978_10009251

Scaffold Ga0114978_10009251


Overview

Basic Information
Taxon OID3300009159 Open in IMG/M
Scaffold IDGa0114978_10009251 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7661
Total Scaffold Genes24 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)15 (62.50%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Simoncouche, Canada
CoordinatesLat. (o)48.2311Long. (o)-71.2508Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015601Metagenome / Metatranscriptome253Y
F045760Metagenome / Metatranscriptome152N
F046374Metagenome / Metatranscriptome151N
F066790Metagenome / Metatranscriptome126N

Sequences

Protein IDFamilyRBSSequence
Ga0114978_100092511F045760GGAGMASVSKSKQAYSALYKSSTRWATNRKIKLTRLLKQQPNNEQIKDALANIKYRRHTPTAKTVWSHGNIRLAKLFKEFTGRASADLFSSNPKVQAGALAYRRDWDKVRVIEGKVSFSLGARAHDSKGN
Ga0114978_1000925112F066790N/AMLSNLMQHLQDMLKPYTLDDFMEDAQPVDHKDIQRLETVWNNYQQRKLFNSCY*
Ga0114978_1000925119F015601GGAGMAGYTKEFLIDAFMSRYVNCDHLSIEKLERLEIMANDLYDRVGRDQFRVYACLDAEAIRDYKTKVTA*
Ga0114978_100092515F046374AGGMAKTFGNLKSTKLDMLDKLTMGKFAGCRICDIIQDDFEYLIWLNKQGFVNFTTPVMTDLLSRAGFKETEEHYKNEIEPWESEDVPL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.