NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0118671_1000520

Scaffold Ga0118671_1000520


Overview

Basic Information
Taxon OID3300009121 Open in IMG/M
Scaffold IDGa0118671_1000520 Open in IMG/M
Source Dataset NameSyntrophic microbial communities from biogas reactors in Seattle, WA - R1.C12.But.A IDBA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMolecular Research LP (MR DNA)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)28759
Total Scaffold Genes29 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)20 (68.97%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Wastewater Sludge → Syntrophic Microbial Communities From Biogas Reactors In Seattle, Wa

Source Dataset Sampling Location
Location NameSeattle, WA
CoordinatesLat. (o)47.652555Long. (o)-122.304991Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F103505Metagenome / Metatranscriptome101Y

Sequences

Protein IDFamilyRBSSequence
Ga0118671_100052024F103505AGGAGGMDPTMLREYENKLAAWLAQGYQLLADDVDGELRLTVHFVSRDGAVGSEREQEFWPMTAEIVELLNDNGITISRALAGPRPWAGPHPEDL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.