| Basic Information | |
|---|---|
| Taxon OID | 3300009119 Open in IMG/M |
| Scaffold ID | Ga0117938_104428 Open in IMG/M |
| Source Dataset Name | Lake sediment microbial communities from Leach Lake, MN |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Minnesota - Twin Cities |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 958 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Sediment → Unclassified → Unclassified → Lake Sediment → Freshwater Sediment Microbial Communities |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Leech Lake, MN | |||||||
| Coordinates | Lat. (o) | 47.18868 | Long. (o) | -94.626271 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F084900 | Metagenome / Metatranscriptome | 112 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0117938_1044282 | F084900 | AGGGGG | MSPELIDDVRVCLAFIEALRRTADMIFSKEEITISEKMKIGGPVIYTIVAHKENGDSLRASGQAYIYSDLIVVCIESVCKALGEPTSPHHYEYLSY* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |