NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0117902_1066492

Scaffold Ga0117902_1066492


Overview

Basic Information
Taxon OID3300009104 Open in IMG/M
Scaffold IDGa0117902_1066492 Open in IMG/M
Source Dataset NameMarine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 2.7-0.2um
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterGeorgia Genomics Facility
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)4183
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Water Column Microbial Communities Of The Permanently Stratified Cariaco Basin, Venezuela

Source Dataset Sampling Location
Location NameCariaco Basin, Venezuela
CoordinatesLat. (o)10.5Long. (o)-64.66Alt. (m)Depth (m)143
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F052191Metagenome143Y

Sequences

Protein IDFamilyRBSSequence
Ga0117902_10664922F052191AGGMVHIPSNKIHSLDPESRAAEVGLLDAEIGTLKADNRSLRAVNKILEQDKKDLESEIEKLRAELEELKKENS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.