NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0103741_1073003

Scaffold Ga0103741_1073003


Overview

Basic Information
Taxon OID3300008938 Open in IMG/M
Scaffold IDGa0103741_1073003 Open in IMG/M
Source Dataset NameEukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4A
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterJ. Craig Venter Institute (JCVI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)678
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica → Eukaryotic And Microbial Communities From Ice Edge, Mcmurdo Sound, Antarctica

Source Dataset Sampling Location
Location NameIce edge, McMurdo Sound, Antarctica
CoordinatesLat. (o)-77.36Long. (o)164.28Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F094877Metatranscriptome105N

Sequences

Protein IDFamilyRBSSequence
Ga0103741_10730031F094877N/ADAVFIPQRLRQYITDHELIDTPHGLYLENCQDVQYGYFGNLEVISNTGVKALEDGLEECHTAFAPCANDGCDWEWGAWGEDVFVQRCMDHHYVDKVEAFDLTRDGACESDRPLEQKKNKKWKSPDCTTEVAASVHPFKKPAEYFKCMGEIMQTSYDV*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.