NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114363_1010634

Scaffold Ga0114363_1010634


Overview

Basic Information
Taxon OID3300008266 Open in IMG/M
Scaffold IDGa0114363_1010634 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Michigan
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4376
Total Scaffold Genes14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (57.14%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton → Harmful Algal Blooms In Lake Erie

Source Dataset Sampling Location
Location NameLake Erie, USA
CoordinatesLat. (o)41.7026Long. (o)-83.2538Alt. (m)Depth (m)5.9
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002037Metagenome / Metatranscriptome600Y
F003066Metagenome / Metatranscriptome509Y
F019123Metagenome / Metatranscriptome231Y
F030690Metagenome / Metatranscriptome184N

Sequences

Protein IDFamilyRBSSequence
Ga0114363_101063410F003066AGGAMKKEPVAWLYEEFDVKSGDLKKSYLWSFHPKELSYLNDLKNATHHIKITPLFRGDKIEEYKSMNKYSEATQRLIESNNGL*
Ga0114363_10106345F030690AGGAMQRSEVEIICNHMLGRVIVSCEPLHGDSTIVITLDDDSLIEISGEELSVYGELTPMDD*
Ga0114363_10106346F002037GAGMNKIYWIFIVVMASLAIWGTEKAFSQTTTILAPDGSVTVCQVGSNGIVVCV*
Ga0114363_10106349F019123N/AMDSKPLSQEEIVKIYKEAFGKGDQLVTIDRIFRFARLIEQAHGVKDG*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.