Basic Information | |
---|---|
Taxon OID | 3300008263 Open in IMG/M |
Scaffold ID | Ga0114349_1215205 Open in IMG/M |
Source Dataset Name | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-53-LTR |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Michigan |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 674 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton → Harmful Algal Blooms In Lake Erie |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Lake Erie, USA | |||||||
Coordinates | Lat. (o) | 41.7635 | Long. (o) | -83.3309 | Alt. (m) | Depth (m) | 4 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F027424 | Metagenome | 194 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0114349_12152051 | F027424 | N/A | IMIKNDLSEIFFALKNHHDKKLILYKKIAGISLLSREYLCCNMFMMTFNDVVSIYKGITIDNVVSLNVYENPSFCCTLFVFKNGSGFGVLSLRNFKKNEFITCYLGEVNENPSDEEYTFKKINGKPVKSASGLLEEYWFGHRIQHGSGNRVTVSLTTGYEIKAKKDIEIGEELFLDYNRSIVCGKCKAESDFYDLCFKKSKKCNFCGNMCLKLKKCSNCEACFI |
⦗Top⦘ |