| Basic Information | |
|---|---|
| Taxon OID | 3300008263 Open in IMG/M |
| Scaffold ID | Ga0114349_1000081 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-53-LTR |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Michigan |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 61008 |
| Total Scaffold Genes | 95 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 48 (50.53%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Cyanobium → unclassified Cyanobium → Cyanobium sp. | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton → Harmful Algal Blooms In Lake Erie |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lake Erie, USA | |||||||
| Coordinates | Lat. (o) | 41.7635 | Long. (o) | -83.3309 | Alt. (m) | Depth (m) | 4 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F081286 | Metagenome | 114 | Y |
| F088247 | Metagenome | 109 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0114349_10000815 | F088247 | GAGG | VPLEQPAKPGAPPRTELSERLIVENQGLAEAAAAKWSRRCSRPFEDFIGPALEGLINGCRRYDPHRINPATDRPYALSTCVCMFIEGAIKHHIRDHGYDVKMPSKWREHYPKVRRLIAEGQTLAQIVEALPVFTEDEITEMLGGMVGTVELEDELTLFSQHQPQAVEVALAPALFALTEAAFTNLRPADRGLLERWAADPFKRPFPSGPMIQFHNRLKTQLRGRTLEQFKQGLLGLDVATIAPAPRERRPRQPRPASVEVVQPSLFARRKPHPKAVKL* |
| Ga0114349_100008154 | F081286 | AGGAGG | MAEATSRVALTIPRLALTIAEAAEALGVSERHVKRLVAEADANRRSRWRWGRELIDLAPVGSSRRCVRVNVAAVAPGTGQPSASP* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |