NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0105349_10473760

Scaffold Ga0105349_10473760


Overview

Basic Information
Taxon OID3300008253 Open in IMG/M
Scaffold IDGa0105349_10473760 Open in IMG/M
Source Dataset NameMethane-oxidizing microbial communities from mesocosms in the Hudson Canyon - EN1B Hudson Canyon
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)523
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosopelagicus → unclassified Candidatus Nitrosopelagicus → Candidatus Nitrosopelagicus sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Methane Seep Mesocosm → Methane-Oxidizing Microbial Communities From Mesocosms In The Gulf Of Mexico And Hudson Canyon, Usa

Source Dataset Sampling Location
Location NameHudson Canyon
CoordinatesLat. (o)39.55Long. (o)-72.4Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F036919Metagenome / Metatranscriptome169Y

Sequences

Protein IDFamilyRBSSequence
Ga0105349_104737601F036919N/AMDQLMDEEIQLNFEIIDTLKVLVQHTKWDSNNLKIKLEELISQHDIIDSELYQIGFYDKPSKEVKG*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.