NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114355_1007046

Scaffold Ga0114355_1007046


Overview

Basic Information
Taxon OID3300008120 Open in IMG/M
Scaffold IDGa0114355_1007046 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Michigan
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)15215
Total Scaffold Genes19 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)15 (78.95%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton → Harmful Algal Blooms In Lake Erie

Source Dataset Sampling Location
Location NameLake Erie, USA
CoordinatesLat. (o)41.7026Long. (o)-83.2538Alt. (m)Depth (m)5.9
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007364Metagenome / Metatranscriptome352Y
F098750Metagenome / Metatranscriptome103Y

Sequences

Protein IDFamilyRBSSequence
Ga0114355_100704614F007364AGGAGMPYPTYTDEQITEFIEIAGEMGIGPAMRHLGYPKSYHTAKKFFVQRNIDTPTANSLAVMAKQLDIFYTDKEKVLAAQAVIDRTVEALYEDNLVSDDISKLSNALHKAIQTINLIEGKSTNINENRSKDGSDLAIVDMLNEAKNFYSKNYIKGKRRI*
Ga0114355_10070462F098750AGGMDVRVEAGPLTAGAVMVESKTVVEQTSNVVIIAPTVSRFSLAPVISVGGKSISAVNPQFFKRESMAVA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.