


| Basic Information | |
|---|---|
| Taxon OID | 3300007852 Open in IMG/M |
| Scaffold ID | Ga0104935_109528 Open in IMG/M |
| Source Dataset Name | Non-marine hypersaline water microbial communities of A?ana Salar, Pa?s Vasco, Spain - Cell Surgencia A?ana 2014 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Alicante |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1541 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline Water → Non-Marine Hypersaline Water Microbial Communities Of A??Ana Salar, Pa??S Vasco, Spain |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | A?ana Salar (Pa?s Vasco, Spain) | |||||||
| Coordinates | Lat. (o) | 42.80111387 | Long. (o) | -2.985507 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F003128 | Metagenome | 506 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0104935_1095282 | F003128 | GGAGG | MQVEIEVDPEDIVKKKADDRGRVTLGAEYAGKKVRVAVLEVVEE* |
| ⦗Top⦘ |