Basic Information | |
---|---|
Taxon OID | 3300007758 Open in IMG/M |
Scaffold ID | Ga0105668_1058866 Open in IMG/M |
Source Dataset Name | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample CTDPlume_2015_DNA CLC_assembly |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | Marine Biological Laboratory |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1348 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Axial Seamount, northeast Pacific Ocean | |||||||
Coordinates | Lat. (o) | 45.9372 | Long. (o) | -130.082 | Alt. (m) | Depth (m) | 1500 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F025151 | Metagenome / Metatranscriptome | 203 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0105668_10588664 | F025151 | N/A | KKPKRRFPSDFNNEEYLEWTSISSDNVDYEVTPLVKGAGRLGELVDWCDDNCNKFYIIGKANKIYFEDENDAAMFTLVWK* |
⦗Top⦘ |