NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0102945_1000034

Scaffold Ga0102945_1000034


Overview

Basic Information
Taxon OID3300007609 Open in IMG/M
Scaffold IDGa0102945_1000034 Open in IMG/M
Source Dataset NameSalt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_H2O_MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)54600
Total Scaffold Genes91 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)31 (34.07%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water → Salt Pond Water, Soil And Salt Crust Microbial Communities From South San Francisco Under Conditions Of Wetland Restoration.

Source Dataset Sampling Location
Location NameSouth San Francisco, USA
CoordinatesLat. (o)37.4958Long. (o)-122.1331Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006200Metagenome / Metatranscriptome379Y
F023608Metagenome / Metatranscriptome209Y
F049240Metagenome / Metatranscriptome147Y

Sequences

Protein IDFamilyRBSSequence
Ga0102945_100003443F023608N/AMKNLTEEIGRICNLLEDAHEEQDWKLVQKMINALDDVYEMLERQDSGYYYED*
Ga0102945_100003448F049240GAGMNNPLNVKPMSYKRFNRHELFDDFLVEYHSTTIKRATDYIWETQGEVFTKLENLLCGIWDGYLYDELLTKALILPKEDYRRVEDIVQLINEHIEANGESVTQIF*
Ga0102945_100003456F006200N/AMSREKEWLEELVKKYSIPKNDKTEKRGILNETQLKNLKNGKN*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.