Basic Information | |
---|---|
Taxon OID | 3300007519 Open in IMG/M |
Scaffold ID | Ga0105055_11124516 Open in IMG/M |
Source Dataset Name | Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-03 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 557 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater → Freshwater Microbial Communities From Lake Liftoff Mats And Glacier Meltwater In Antarctica |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Lake Bonney | |||||||
Coordinates | Lat. (o) | -77.714 | Long. (o) | 162.445 | Alt. (m) | Depth (m) | 83 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F065445 | Metagenome | 127 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0105055_111245161 | F065445 | N/A | TKGKSIFFLSRVLCVMVFEIPQEGDPVDNEALQAKILTNSSGFILTKHHHIRKYGSIHTLVPGDRRVIEPIHPTKWGEAADLEARPRTIHPDISPKIVSRVFNLVLDPPGNAVILALQDEIYTSATLGYHMRPEPNFDVTCGGGRPVYTRNDALSLQGLPEFSRGLIQWRQGAATRTPDGRLTFD |
⦗Top⦘ |