NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0105021_1109343

Scaffold Ga0105021_1109343


Overview

Basic Information
Taxon OID3300007515 Open in IMG/M
Scaffold IDGa0105021_1109343 Open in IMG/M
Source Dataset NameMarine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 2.7-0.2um, replicate b
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterGeorgia Genomics Facility
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1694
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED264(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Water Column Microbial Communities Of The Permanently Stratified Cariaco Basin, Venezuela

Source Dataset Sampling Location
Location NameCariaco Basin, Venezuela
CoordinatesLat. (o)10.5Long. (o)-64.66Alt. (m)Depth (m)143
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000659Metagenome / Metatranscriptome952Y
F004439Metagenome438Y
F084712Metagenome / Metatranscriptome112Y

Sequences

Protein IDFamilyRBSSequence
Ga0105021_11093431F000659N/AMKTFSQYLKEANSKYIVSKNPNDKKWYVMGHVGNNKWMPVSNGFKNKAQAQKWAKSQDKVDSAARGEIGDV*
Ga0105021_11093433F004439GAGMITFKQYLREFRGGSSLSDMLFMPSIKSYDRLKIPISSSMYKRIWPETLRATVFHTTDEDGVKAIAKLQGKKKQISAFFSMQSKYMEKGIATYGVARSVLEMDADVILSAKGDVMTDVDRVGRRYTTISDLQETSRWTDFKKVEKDLETMFTKLVNKYLERDKFQSTLDEFGLWHMAKRKVDGKTMRLIIKDYLDGVESVIKKNIKTFSSAMLSYAKKRETDYSWDEQVVNNFNVKTAHFFKLKLDKDGENSLVLPQNELIEFAKSQGWKTKMWNAAIELEIYTREVAKKELGK*
Ga0105021_11093434F084712AGGAGMKTFRYIREGGLDDKLDKYVSNEIKKRKLARFPVNATDDYQMKKGKPAFTFPSPTGSMVIHVWLR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.