NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0104999_1004390

Scaffold Ga0104999_1004390


Overview

Basic Information
Taxon OID3300007504 Open in IMG/M
Scaffold IDGa0104999_1004390 Open in IMG/M
Source Dataset NameMarine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 267m, 2.7-0.2um, replicate a
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterGeorgia Genomics Facility
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)13919
Total Scaffold Genes19 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)12 (63.16%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Water Column → Marine Water Column Microbial Communities Of The Permanently Stratified Cariaco Basin, Venezuela

Source Dataset Sampling Location
Location NameCariaco Basin, Venezuela
CoordinatesLat. (o)10.5Long. (o)-64.66Alt. (m)Depth (m)267
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001334Metagenome / Metatranscriptome720Y
F003285Metagenome / Metatranscriptome496Y

Sequences

Protein IDFamilyRBSSequence
Ga0104999_100439016F001334GGAMLKFKEYIKIESDDSINQVMSGDWISKSRSTWKAVDDEDNKIEIHNDGHDPELNGESWTIYENTFAPKAFAHYCKQFLETVKPVELSYAGTRIYPST*
Ga0104999_100439017F003285AGTAGMPEQESIHQLKSEIQTLKIKDEYRSKELDALMSKLDDTTTKLNALSENIGRLLAGQELNKTIDNDVRDELKILHSRIGDLHDKMNHMIDKTEARIDSDINSLFKKIDSLEKWRWITIGAATLIAWLLTNIIPKFIQN*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.