NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0079242_1159482

Scaffold Ga0079242_1159482


Overview

Basic Information
Taxon OID3300007338 Open in IMG/M
Scaffold IDGa0079242_1159482 Open in IMG/M
Source Dataset NameSeawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S5 c16 DCM_B metaT (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)568
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → environmental samples → uncultured virus(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Source Dataset Sampling Location
Location NameSouthern Atlantic ocean
CoordinatesLat. (o)-28.2362Long. (o)-38.4949Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001039Metagenome / Metatranscriptome795Y
F015325Metagenome / Metatranscriptome255Y

Sequences

Protein IDFamilyRBSSequence
Ga0079242_11594822F001039N/AMIDYNLVLYIGMGLIVFGFVLFLVSIHFEREAEIKLFKQEQLDKAFRKAKENERL*
Ga0079242_11594823F015325N/AMTNKKWFVIEKQSYGTSGDNFSISKIADTVEQATTFKIHLDALNERKNYSYFIASDISSVVDKVVYHHNKSVEEKPLILKDEIKEDSSEMPF*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.