NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0098041_1016142

Scaffold Ga0098041_1016142


Overview

Basic Information
Taxon OID3300006928 Open in IMG/M
Scaffold IDGa0098041_1016142 Open in IMG/M
Source Dataset NameMarine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2456
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (20.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)-11.499Long. (o)-81.401Alt. (m)Depth (m)75
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F017293Metagenome / Metatranscriptome241Y
F018192Metagenome / Metatranscriptome236Y
F090363Metagenome / Metatranscriptome108N

Sequences

Protein IDFamilyRBSSequence
Ga0098041_10161422F018192N/AMSYRSEFPYLNALLGLGLIGQSFFSMSLLSKANNGIPDLSRLATTNNSASQLRYTKDGEKLDVMMTLNMHSPKTTLFSTEKTKWHGKTDYHRKEYIAHKPLDNARLTAEYLQCIKNKGSAESQGEIVGTSLVTATPAASTLSGIPVIGWIASALAVKKAGQLGKEIGSDFVDC*
Ga0098041_10161423F017293GAGGMMKILTYINTAALVVAVGGGTFAFLNRGKITESIMSEVQKQLPSLVKGAMPKISVPSSTGNVLPF*
Ga0098041_10161424F090363N/AMADRVTLANEIKQLKADQERRASEWKENQQILETKAAELVQANLDELDGGEACPA*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.