NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0066376_10341516

Scaffold Ga0066376_10341516


Overview

Basic Information
Taxon OID3300006900 Open in IMG/M
Scaffold IDGa0066376_10341516 Open in IMG/M
Source Dataset NameSeawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_Bottom_ad_5009_LV_A
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)866
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Marine Group I → Marine Group I thaumarchaeote(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Source Dataset Sampling Location
Location NameSouthern Atlantic ocean
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015491Metagenome254Y
F020795Metagenome / Metatranscriptome222Y
F042565Metagenome / Metatranscriptome158Y

Sequences

Protein IDFamilyRBSSequence
Ga0066376_103415162F015491N/AMEYFSNGAIMKKTKRQRRVKVPARPQVTPRKWSKKTARIFDKQFDRFLYDELYVPTKKAWGEEIVKYERDMFGDSK*
Ga0066376_103415163F020795AGGAMKTATLEVLNEGELIFGTRTNGSYFVREYEDDEEVAGSFFKIEEEAKTYIETLNEK*
Ga0066376_103415164F042565N/ADVKEFNRIESLVNKRVRWELGSEGYSIWSECGYKDIPTLAKAYRIS*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.