Basic Information | |
---|---|
Taxon OID | 3300006804 Open in IMG/M |
Scaffold ID | Ga0079221_10944275 Open in IMG/M |
Source Dataset Name | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 639 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil → Agricultural Soil Microbial Communities From Utah And Georgia To Study Nitrogen Management |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Georgia | |||||||
Coordinates | Lat. (o) | 33.8834 | Long. (o) | -83.4195 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F044703 | Metagenome / Metatranscriptome | 154 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0079221_109442751 | F044703 | N/A | TSTSRARSKRSGPDVPLAIAIGIIVVLLGFLLWAIAHEKGPSAPDVAIGYEHAWDELDFGVLWDLSGPELREGLRRDQFIAAKRAAYANEPHGRLAERIDVDTFVEGNQSALVVTRVTADGASVRNDVLLERRANGWTVVGYSLRPGGGSDAAPARHDDRPA* |
⦗Top⦘ |