NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0066659_10051324

Scaffold Ga0066659_10051324


Overview

Basic Information
Taxon OID3300006797 Open in IMG/M
Scaffold IDGa0066659_10051324 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2604
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameUSA: California: Angelo Coastal Reserve
CoordinatesLat. (o)39.7392Long. (o)-123.6308Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F017701Metagenome / Metatranscriptome239Y
F074693Metagenome119N
F088658Metagenome / Metatranscriptome109N

Sequences

Protein IDFamilyRBSSequence
Ga0066659_100513241F088658AGGAGMPTADNADDLVRFRNVTVISSTATALFCGVGGKSVWLPRRHISGRLSCMGDRGTLLIRRWVAHDRSLLRPPARVAVSVLGPSMSRRRL
Ga0066659_100513242F017701GGAVQYEDTIEIRGVTVMRQTDVALLCRVGNQHRWIAPTQLQPGSTVARSGDVGTIVLKRPFAVEQGLVPFQGLHD*
Ga0066659_100513244F074693N/AMNLDQPTYETMNRINAAIAQAMELCPRPELVSWGRRWISGDDRSRETVASIAAAIGVVNVPPDPFARELEEAGRRALVPDELFDWTTKGAVLAALEWTRADPKVGKYHENLAGRIAFLASLMGETWNANRRLIGRRLSPAPDASPQGPPGLH*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.