NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0066658_10068268

Scaffold Ga0066658_10068268


Overview

Basic Information
Taxon OID3300006794 Open in IMG/M
Scaffold IDGa0066658_10068268 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1583
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location NameUSA: California: Angelo Coastal Reserve
CoordinatesLat. (o)39.7392Long. (o)-123.6308Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000415Metagenome / Metatranscriptome1168Y
F020334Metagenome / Metatranscriptome224Y
F061747Metagenome / Metatranscriptome131Y

Sequences

Protein IDFamilyRBSSequence
Ga0066658_100682682F061747GGAGGMKVLKAESTGAEVKVWCESCCIRVAPNEERTVVHGKTYHSHCYSKLNGKPKVDVQGSQA*
Ga0066658_100682683F000415GGGGGLDERFSGEFSAALLAFRAEAVVYCRGISDTVAREYAEEYAAMLQNRAKGIEAQLPRIPSGLFEPNRNLIRSTLDRMWEKYFPDK*
Ga0066658_100682684F020334GGAGMKDPKVIFRYLGFQALSDGGRRFDFSFAGSDASQHVISVQAPHDLFDGPDPMSIQECPGICYETLKCHVAGWSAVPASISLTSAAVVQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.