NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0098071_120661

Scaffold Ga0098071_120661


Overview

Basic Information
Taxon OID3300006768 Open in IMG/M
Scaffold IDGa0098071_120661 Open in IMG/M
Source Dataset NameMarine viral communities from Cariaco Basin, Caribbean Sea - 29_WHOI_OMZ
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)558
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → environmental samples → uncultured virus(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NameCaribbean Sea: Cariaco Basin
CoordinatesLat. (o)10.847Long. (o)-65.114Alt. (m)Depth (m)143
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000161Metagenome / Metatranscriptome1845Y

Sequences

Protein IDFamilyRBSSequence
Ga0098071_1206611F000161GAGGMKKFTIEVSHAAPGQLQTIAAELKIMSNGWERFGPRIMINGQKLQAPSLREPRHKRQATSHKRHNMARFI*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.