NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0098042_1000185

Scaffold Ga0098042_1000185


Overview

Basic Information
Taxon OID3300006749 Open in IMG/M
Scaffold IDGa0098042_1000185 Open in IMG/M
Source Dataset NameMarine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)23698
Total Scaffold Genes49 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)13 (26.53%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)-14.198Long. (o)-77.499Alt. (m)Depth (m)38
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002047Metagenome / Metatranscriptome599Y
F004866Metagenome420Y

Sequences

Protein IDFamilyRBSSequence
Ga0098042_100018513F002047N/AMWDLFQVMLSKNVTPNQVLLMFGMKNGVSTPAVNTKEEDKLHLVKIGYLDENNGVYSLTPTAKAFCIRLDNYFIKAKKKTDIQLMGKKYVTWINDYREIFPNKKLPSGKPARNNVKALGEAFRWFFNTYEHDWATVFAATKMYVNEYRDKDYMYMQTSQYFICKQDKHRVKHSTLADYCDMIIDGIDTEEDHFKENVV*
Ga0098042_100018544F004866GAGMALVKKVDLKLKVGMDKCIMYQILSYCFFKEIIISNSDLKFLMELSKRNGIELTKFCIELVSKDIFKSPQSARNAITKAAKKGLVIKNGTNKKTISINSDINVQVEGLVLLDYKILGNESQEA*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.