NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0079301_1085201

Scaffold Ga0079301_1085201


Overview

Basic Information
Taxon OID3300006639 Open in IMG/M
Scaffold IDGa0079301_1085201 Open in IMG/M
Source Dataset NameDeep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)981
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (20.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface → Deep Subsurface Shale Carbon Reservoir Microbial Communities From Ohio And West Virginia, Usa

Source Dataset Sampling Location
Location NameUSA: Ohio
CoordinatesLat. (o)40.178Long. (o)-81.073Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004134Metagenome / Metatranscriptome451Y
F007919Metagenome / Metatranscriptome342Y
F049618Metagenome / Metatranscriptome146N

Sequences

Protein IDFamilyRBSSequence
Ga0079301_10852012F007919N/AMTEKVKFVSISRTISDSSGIHYLDAIDENGIHWMAQMEIGVERWITYKEVWKKDPQQPYDL*
Ga0079301_10852013F004134N/AMKHPANDWDFDDTIEEAFQEWFNDLNGGFAFRSEYFFGDCEVEDVNTRKDLMYKWLHSAFVMGYNMGRMEGLEVGLTNNED*
Ga0079301_10852014F049618AGTAGGMKIEITITSHPTKGCTATIWDGPDGIDEDSFVCRNLGECFEQIVMWRTINAQKYVEETEND*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.