NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0101442_107511

Scaffold Ga0101442_107511


Overview

Basic Information
Taxon OID3300006622 Open in IMG/M
Scaffold IDGa0101442_107511 Open in IMG/M
Source Dataset NameMarine coastal surface water microbial communities in Port Hacking, Sydney, Australia ? TJ08 time point
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterAustralian Centre for Ecogenomics
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2285
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (25.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water → Exploring Phylogenetic Diversity In Port Hacking Ocean In Sydney, Australia

Source Dataset Sampling Location
Location NamePort Hacking, Australia
CoordinatesLat. (o)-34.1192Long. (o)151.2267Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F031863Metagenome / Metatranscriptome181Y
F056582Metagenome / Metatranscriptome137Y
F057337Metagenome / Metatranscriptome136N
F071664Metagenome / Metatranscriptome122Y

Sequences

Protein IDFamilyRBSSequence
Ga0101442_1075114F056582GGAMARYKTYKIENTPSEKFPQMVTISKKLKGNLFEKKFISEQKAKAWIEFGAAHKLINNGAKKVKNELGSIGILTETAAW*
Ga0101442_1075115F057337N/AMTYSELSTMTIEDLRTLNSMVVETIKSKKSLLALEKKDSLYVGAIVSVDHPKMAGHELKVTKINRTKAVCELINGLGSYNVPLNMINIING*
Ga0101442_1075116F031863N/AMLDRKLLPVGNDLYVIKRKFKIEHWDKIVQHFGAKEVCEAYHCETILRGRDGYFYLCDKVDDAKIIE*
Ga0101442_1075117F071664N/AMIKKIKSKLLTYLFTDWVKSETDLETIKLTSQMLKNREIQITGIKPVLGFRAHHKNQIQ*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.