NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0101444_121567

Scaffold Ga0101444_121567


Overview

Basic Information
Taxon OID3300006620 Open in IMG/M
Scaffold IDGa0101444_121567 Open in IMG/M
Source Dataset NameMarine coastal surface water microbial communities in Port Hacking, Sydney, Australia ? TJ10 time point
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterAustralian Centre for Ecogenomics
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2358
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water → Exploring Phylogenetic Diversity In Port Hacking Ocean In Sydney, Australia

Source Dataset Sampling Location
Location NamePort Hacking, Australia
CoordinatesLat. (o)-34.1192Long. (o)151.2267Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F038656Metagenome165N

Sequences

Protein IDFamilyRBSSequence
Ga0101444_1215674F038656N/ASAMQFRDDRQQPGDIVIFFTTENSRQWFFEDRPHLSNLASITDTPDARELQKAEPAKYRAIMEYWLYLQRDDVDQLRMEHMIDSIRVKQIENELHLLLIPSFNSSMMWTDLIPVKGNMTFSVCDREFVNEQEMVKWYNQSIDTRANHMTLENHTVLARKIVRSLDEHVLLDLEEGFATGFLTHRDKLTHPGLLPELIEMAKQPGNTIPK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.